PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010097794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GRAS
Protein Properties Length: 589aa    MW: 66544 Da    PI: 4.9013
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010097794.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.51.7e-912145851374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalkl.fsevsPilk 92 
                     lvelLl+cAe v  +++e+a +lL++  +l+s +g+p+qR++ yf eAL+ r+ + ++ +  k l + +  +++    +l+a++  f+e+ P+ +
  XP_010097794.1 214 LVELLLACAEKVGCQQFERAGKLLNQCDQLCSTTGNPVQRVVYYFCEALRGRIDKeTGRSKTKGLgKEQLFDPDVAMMRLNATHHaFHETIPFSQ 308
                     689***************************************************96566666666566666666666666665555********* PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                     +s ++  qaI+e+veg++++HiiDf i  GlQW  L+qaLas   ++   l+iT++g    ++k+ +eetgerL +fA++l++p++f++++++++
  XP_010097794.1 309 LSIFAGIQAIVESVEGAKKIHIIDFAIRSGLQWTVLMQALASCHeSPLELLKITALGT---TQKHVIEETGERLLSFAQTLNIPLSFKIVMVSDM 400
                     *****************************************776266669********...589******************************* PP

            GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                     + l+ e ++++ +E+++  + +   ++l+ + +     ++ +++++sl+P v+vv+e ea++ns+sF++rf+eal +y a fd+le+ + r+ ++
  XP_010097794.1 401 THLKQELFELDFDEKVICYSYFLFRSMLALPDQ----LESAMRVMRSLNPCVMVVTEVEANMNSPSFANRFIEALFFYGAYFDCLETFMKRDCRN 491
                     *****************9999988888755555....555******************************************************* PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r+  E  ++g+ i+n va+eg+er+ r+ +   Wr+ +++ G++ v+ls +   q++l+l+k++ +d  +++ + ++l++ Wk+ p+ s+S+W+
  XP_010097794.1 492 RMAAESLYFGEGIRNTVAAEGKERKIRNVSIDVWRAFFTRYGLEDVELSPSSLYQVELILKKFScEDSCTLDVNGNCLIFLWKGTPIQSLSVWK 585
                     ****************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.403188564IPR005202Transcription factor GRAS
PfamPF035145.8E-89214585IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MISSGKLSSS GVEDKLGSND KSSGSMEEDN IEYRVGFCGE NLWDSTNACY LSPEFGFLQD  60
DYSAEEFLFS KYQLHEEKYS EFGLLNDARF NVASPPLDKC LEEIAKLGED EIPSVISGIG  120
ESKKENKFPF PLASLELLRN YSGGLRRLKR ERRVMEPSND STCGEVGDKR LSCVEIMKIA  180
GARFIQSSSL EANNHPFERS LCGLSNEDTK DVELVELLLA CAEKVGCQQF ERAGKLLNQC  240
DQLCSTTGNP VQRVVYYFCE ALRGRIDKET GRSKTKGLGK EQLFDPDVAM MRLNATHHAF  300
HETIPFSQLS IFAGIQAIVE SVEGAKKIHI IDFAIRSGLQ WTVLMQALAS CHESPLELLK  360
ITALGTTQKH VIEETGERLL SFAQTLNIPL SFKIVMVSDM THLKQELFEL DFDEKVICYS  420
YFLFRSMLAL PDQLESAMRV MRSLNPCVMV VTEVEANMNS PSFANRFIEA LFFYGAYFDC  480
LETFMKRDCR NRMAAESLYF GEGIRNTVAA EGKERKIRNV SIDVWRAFFT RYGLEDVELS  540
PSSLYQVELI LKKFSCEDSC TLDVNGNCLI FLWKGTPIQS LSVWKSFQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-402145854375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097794.10.0hypothetical protein L484_004208
TrEMBLW9RU080.0W9RU08_9R
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-50RGA-like 2